G3BP1 anticorps

N° du produit ABIN634465

Cet anticorps Lapin Polyclonal détecte spécifiquement G3BP1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour G3BP1 anticorps (ABIN634465)

Antigène: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp G3BP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-G3BP1 anticorps

Purification: Affinity purified

Immunogène: G3 BP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

G3BP1 Blocking Peptide, (ABIN5613683), is also available for use as a blocking control in assays to test for specificity of this G3BP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur G3BP1

Antigène: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Autre désignation: G3BP1

Sujet: This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome